Related searches for xanthine phosphoribosyltransferase
|
Xanthine phosphoribosyltransferase
Thus, the two substrates of this enzyme are XMP and diphosphate, whereas its two products are 5-phospho-alpha-D-ribose 1-diphosphate and xanthine.
More »
Go to: Wikipedia · Ask Encyclopedia
Search for: Related Q&A · Images · Videos
|
Apr 8, 1997 ... Xanthine phosphoribosyltransferase (XPRT; EC 2.4.2.22) from Escherichia coli is a tetrameric enzyme having 152 residues per subunit.
|
||
Genetic separation of hypoxanthine and guanine-xanthine phosphoribosyltransferase activities by deletion mutations in Salmonella typhimurium. Gots JS ...
|
||
Xanthine phosphoribosyltransferase (XPRT) from. Leishmania .... nine phosphoribosyltransferase; XPRT, xanthine phosphoribosyltrans- ferase; HGXPRT ...
|
||
Protein Sequence, >Xanthine phosphoribosyltransferase MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI ...
|
||
xanthine Phosphoribosyltransferase Produced by a High Efficiency. Expression ... Guanine-xanthine phosphoribosyltransferase (EC 2.4.2.22) is a bacterial ...
|
|
|
The hypoxanthine-guanine-xanthine phosphoribosyl-transferase (HGXPRTase) from this organism has been purified to homogeneity by ammonium sulfate ...
|
||
Dec 14, 2011 ... >sp|P47165|XPT1_YEAST Xanthine phosphoribosyltransferase 1 OS= Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XPT1 ...
|
||
xanthine phosphoribosyl transferase is a major target antigen for ... xanthine guanine xanthine phosphoribosyl transferase (HGXPRT). Recombinant HGXPRT ...
|
||
(1998) Doyle et al. Experimental Parasitology. Read by researchers in: 100% Biological Sciences. All parasitic protozoa examined to date are incapable of de ...
|
